LL-37 5 mg - Human Antimicrobial Peptide for Immunological and Cellular Research

LL-37 is a human-derived antimicrobial peptide belonging to the cathelicidin family. It is the only known human cathelicidin capable of broad-spectrum activity and is widely used in laboratory environments to study innate immunity, cellular defense mechanisms, wound-healing pathways, and microbial interaction models. LL-37 is of particular interest in research focused on epithelial barrier function, immunomodulation, and host–pathogen dynamics.

Each vial contains 5 mg of high-purity LL-37 produced under GMP-compliant laboratory conditions and sealed in tamper-evident packaging to ensure analytical integrity. Researchers in Colombia rely on Poly Biotech for consistent access to advanced antimicrobial peptides for controlled studies in immunology and cellular biology.

Key Features

• 5 mg pharmaceutical-grade LL-37 peptide per vial
  
• Lyophilized powder for enhanced stability
• Tamper-evident vial with precise research labeling
• Free, discreet nationwide shipping within Colombia

Applications in Research

LL-37 is commonly used in laboratory studies involving:

• Innate immune response and antimicrobial defense pathways
• Cellular models of wound interaction and tissue regeneration
• Host–pathogen interaction studies with bacteria, fungi, and viruses
• Inflammation, cytokine regulation, and epithelial barrier function
• Comparative research with human defensins and other cathelicidins

Technical Information

• Compound: LL-37 (human cathelicidin peptide)
• Sequence: [LL-37, 37 aa]
• Form: Lyophilized powder
• Content: 5 mg per vial
• Purity: ≥ 98% (HPLC-verified)
• Appearance: White to off-white powder
• Storage: Store at 2–8 °C; protect from moisture and light
• Use: Intended exclusively for laboratory research

References

• PubChem – LL-37
• NCBI – LL-37 in host defense and inflammation
• Wikipedia – Cathelicidin Family

For dosing and usuage information, visit Guía Péptidos, an independent website unaffiliated with Poly Biotech.

Poly Biotech does not provide medical or dosing information. If you’d like professional, doctor-guided peptide support, click here

Clinicians and healthcare professionals can explore detailed references, dosing studies, and molecular information in our Peptide Reference Index.

Expand your understanding of peptide science with resources written for beginners, professionals, and researchers.

Explore our full educational ecosystem:

Peptides Explained Simply – A friendly, beginner-level introduction to what peptides are and how they work. Read the guide

Peptide Science Handbook – A deeper, chapter-by-chapter breakdown of peptide fundamentals, synthesis, stability, analysis, and laboratory practices.

Explore our Knowledge Base for peptide research articles, dosing guides, and scientific insights.

All Poly Biotech peptides are produced using a lyophilization (freeze-drying) process that guarantees product stability during shipping and storage. This process removes moisture under controlled low-pressure conditions, creating a stable white powder that preserves the peptide’s structure and potency.

Before reconstitution:

• Lyophilized peptides remain 100% stable for 3–4 months during normal shipping and storage.
• Vials can be safely kept at room temperature if they will be used within a few weeks or months.
• For long-term storage (several months to years), keep vials in a freezer at -20°C to -80°C (-4°F to -112°F) to maximize stability.
  

After reconstitution:

• Once mixed with bacteriostatic water, peptides should be stored in the refrigerator (2–8°C / 36–46°F).
• Reconstituted peptides remain stable for up to 30 days when refrigerated.
• Keep all vials away from direct light and heat to maintain product integrity.
  

By following these guidelines, you’ll ensure your peptides retain their full quality and effectiveness from shipment to final use.

Purity & Standards: All peptides are produced to the highest purity levels and handled in a sterile, sanitary environment.

Packaging: Every vial is securely sealed with tamper-evident closures and clearly labeled for accurate identification.

Intended Use: Products are supplied strictly for research and laboratory purposes only.

Not for Human Use: Not intended for human or veterinary consumption, diagnosis, treatment, or medical applications.

Handling: Store and handle in accordance with best laboratory practices. Use only in properly equipped research facilities.

Keep out of reach of children. Do not use if seal under cap is broken or missing.

Free Shipping: We offer free shipping anywhere in Colombia on all peptide orders.

• Secure Packaging: Every vial is carefully packaged in protective materials to ensure safe delivery.
• Fast Delivery: Orders are typically processed within 1–2 business days. Delivery times vary by city but generally arrive within 2–5 business days across Colombia.
• Tracking: All shipments include tracking so you can follow your order from dispatch to delivery.
• Discreet Service: Packages are shipped in plain, unmarked packaging for privacy.